Mouse Anti-Chicken Wnt3a Antibody (MO-AB-04788Y)
Cat: MO-AB-04788Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus) |
Clone | MO04788Y |
Specificity | This antibody binds to Chicken Wnt3a. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. |
Product Overview | This product is a mouse antibody against Wnt3a. It can be used for Wnt3a detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Wingless-type MMTV integration site family member 3a; Wnt3a |
UniProt ID | A4F2Q1 |
Protein Refseq | The length of the protein is 48 amino acids long. The sequence is show below: MKSFCSEVVAKSRLGLQQWGWCGWTPLGSAWKKWISEQRSSLELWDVG. |
See other products for " WNT3A "
MO-AB-34065W | Mouse Anti-Dog WNT3A Antibody (MO-AB-34065W) |
MO-AB-23894H | Mouse Anti-Mallard WNT3A Antibody (MO-AB-23894H) |
MO-AB-01927R | Mouse Anti-Medaka wnt3a Antibody (MO-AB-01927R) |
MO-AB-35986W | Mouse Anti-Ferret WNT3A Antibody (MO-AB-35986W) |
MO-AB-09674W | Mouse Anti-Cat WNT3A Antibody (MO-AB-09674W) |
MO-AB-10499Y | Mouse Anti-Rabbit WNT3A Antibody (MO-AB-10499Y) |
MO-AB-34036H | Mouse Anti-Nile tilapia wnt3a Antibody (MO-AB-34036H) |
MO-AB-18260Y | Mouse Anti-Sheep WNT3A Antibody (MO-AB-18260Y) |
CBMOAB-16316FYB | Mouse Anti-Zebrafish wnt3a Antibody (CBMOAB-16316FYB) |
MO-AB-09140H | Mouse Anti-Frog wnt3a Antibody (MO-AB-09140H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry