Mouse Anti-Wnt3a Antibody (MO-AB-04788Y)
Cat: MO-AB-04788Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-04788Y | Monoclonal | Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO04788Y | 100 µg | ||
CBMOAB-16316FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO16316FYB | 100 µg | ||
MO-AB-09674W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09674W | 100 µg | ||
MO-AB-13009W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13009W | 100 µg | ||
MO-AB-34065W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO34065W | 100 µg | ||
MO-AB-35986W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35986W | 100 µg | ||
MO-AB-22985R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22985R | 100 µg | ||
MO-AB-01927R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01927R | 100 µg | ||
MO-AB-09140H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO09140C | 100 µg | ||
MO-AB-23894H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23894C | 100 µg | ||
MO-AB-34036H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO34036C | 100 µg | ||
MO-AB-07007Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO07007Y | 100 µg | ||
MO-AB-10499Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10499Y | 100 µg | ||
MO-AB-18260Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18260Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO04788Y |
Specificity | This antibody binds to Chicken Wnt3a. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. (From NCBI) |
Product Overview | This product is a mouse antibody against Wnt3a. It can be used for Wnt3a detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Wingless-type MMTV integration site family member 3a; Wnt3a |
UniProt ID | A4F2Q1 |
Protein Refseq | The length of the protein is 48 amino acids long. The sequence is show below: MKSFCSEVVAKSRLGLQQWGWCGWTPLGSAWKKWISEQRSSLELWDVG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry