Mouse Anti-Wnt3a Antibody (MO-AB-04788Y)


Cat: MO-AB-04788Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04788Y Monoclonal Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO04788Y 100 µg
CBMOAB-16316FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO16316FYB 100 µg
MO-AB-09674W Monoclonal Cat (Felis catus) WB, ELISA MO09674W 100 µg
MO-AB-13009W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13009W 100 µg
MO-AB-34065W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34065W 100 µg
MO-AB-35986W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35986W 100 µg
MO-AB-22985R Monoclonal Cattle (Bos taurus) WB, ELISA MO22985R 100 µg
MO-AB-01927R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01927R 100 µg
MO-AB-09140H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09140C 100 µg
MO-AB-23894H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23894C 100 µg
MO-AB-34036H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO34036C 100 µg
MO-AB-07007Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO07007Y 100 µg
MO-AB-10499Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10499Y 100 µg
MO-AB-18260Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18260Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO04788Y
SpecificityThis antibody binds to Chicken Wnt3a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region.
Product OverviewThis product is a mouse antibody against Wnt3a. It can be used for Wnt3a detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesWingless-type MMTV integration site family member 3a; Wnt3a
UniProt IDA4F2Q1
Protein RefseqThe length of the protein is 48 amino acids long. The sequence is show below: MKSFCSEVVAKSRLGLQQWGWCGWTPLGSAWKKWISEQRSSLELWDVG.
For Research Use Only | Not For Clinical Use.
Online Inquiry