AibGenesis™ Mouse Anti-CALCB Antibody (MO-AB-17654W)


Cat: MO-AB-17654W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-17654W Monoclonal Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO17654W 100 µg
MO-AB-24265R Monoclonal Pig (Sus scrofa) WB, ELISA MO24265R 100 µg
MO-AB-24490H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24490C 100 µg
MO-AB-43898W Monoclonal Horse (Equus caballus) WB, ELISA MO43898W 100 µg
MO-AB-52130W Monoclonal Marmoset WB, ELISA MO52130W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO17654W
SpecificityThis antibody binds to Chimpanzee CALCB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee CALCB Antibody is a mouse antibody against CALCB. It can be used for CALCB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalcitonin-related polypeptide beta; CALCB
UniProt IDK7B3W1
Protein RefseqThe length of the protein is 127 amino acids long.
The sequence is show below: MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQHYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry