Mouse Anti-DENND10 Antibody (MO-AB-10377W)


Cat: MO-AB-10377W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10377W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO10377W 100 µg
MO-AB-11360R Monoclonal Cattle (Bos taurus) WB, ELISA MO11360R 100 µg
MO-AB-25379H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25379C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO10377W
SpecificityThis antibody binds to Chimpanzee DENND10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee DENND10 Antibody is a mouse antibody against DENND10. It can be used for DENND10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFamily with sequence similarity 45, member A; FAM45A
UniProt IDK7CD33
Protein RefseqThe length of the protein is 357 amino acids long.
The sequence is show below: MAAAEVADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDARKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELEALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry