AibGenesis™ Mouse Anti-H4-16 Antibody (MO-AB-23826W)


Cat: MO-AB-23826W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23826W Monoclonal Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris) WB, ELISA MO23826W 100 µg
MO-AB-31076W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31076W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Dog (Canis lupus familiaris)
CloneMO23826W
SpecificityThis antibody binds to Chimpanzee H4-16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Chimpanzee H4-16 Antibody is a mouse antibody against H4-16. It can be used for H4-16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H4; LOC748545; HIST1H4E HIST2H4B
UniProt IDH2RC04
Protein RefseqThe length of the protein is 103 amino acids long.
The sequence is show below: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry