AibGenesis™ Mouse Anti-ITPRIPL1 Antibody (MO-AB-21182W)


Cat: MO-AB-21182W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21182W Monoclonal Chimpanzee (Pan troglodytes), Pig (Sus scrofa) WB, ELISA MO21182W 100 µg
MO-AB-26771R Monoclonal Pig (Sus scrofa) WB, ELISA MO26771R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Pig (Sus scrofa)
CloneMO21182W
SpecificityThis antibody binds to Chimpanzee ITPRIPL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee ITPRIPL1 Antibody is a mouse antibody against ITPRIPL1. It can be used for ITPRIPL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInositol 1,4,5-trisphosphate receptor interacting protein-like 1; ITPRIPL1
UniProt IDK6ZB54
Protein RefseqThe length of the protein is 555 amino acids long.
The sequence is show below: MNVDAEASMAVISLLFLAVMYVVHHPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEGPLGWMLGNLWNTGLFCLFLVFELLRQNMQHEPAFDSSSEEEEEEVHVVPVTSYNWLTDFPSQEALDSFYKHYVQNAIRDLPCTCEFVESFVDDLIEACRVLSRQEAHPQLEDCLGIGAAFEKWGTLHETQKFDILVPIVPPQGTMFVLEMRDPALGRRCGCVLVESECVCKREKLLGDVLCLVHHHRDPSAVLGKCSSSIKAALCTGFHLDVCKTVQWFRNMMGNAWALVAHKYDFKLSLPPSTTSCKLRLDYPSGRFLSIHLVLGVQREDTLVYLVSQAPDQEQLTSVDWPESFVACEHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKTALMHLLLRLPLTDWAHNMLSQRLQDILWFLGRGLQQRSLHHFLIGNTFLPLTIPIPKTFRNAKPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAAAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry