AibGenesis™ Mouse Anti-LGALS13 Antibody (MO-AB-24187W)


Cat: MO-AB-24187W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24187W Monoclonal Chimpanzee (Pan troglodytes), Gorilla, Pig (Sus scrofa) WB, ELISA MO24187W 100 µg
MO-AB-26984R Monoclonal Pig (Sus scrofa) WB, ELISA MO26984R 100 µg
MO-AB-38598W Monoclonal Gorilla WB, ELISA MO38598W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Gorilla, Pig (Sus scrofa)
CloneMO24187W
SpecificityThis antibody binds to Chimpanzee LGALS13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee LGALS13 Antibody is a mouse antibody against LGALS13. It can be used for LGALS13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGalectin; LGALS13
UniProt IDH2QGB4
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MSLTRKLHLCKYWGCALSSVCPFLEGRPWPLMIVVPYKLPVSLSVGSCVIIKGTPIDSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETADYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN.
For Research Use Only | Not For Clinical Use.
Online Inquiry