AibGenesis™ Mouse Anti-MDP1 Antibody (MO-AB-13387W)


Cat: MO-AB-13387W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13387W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO13387W 100 µg
MO-AB-27025H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27025C 100 µg
MO-AB-58898W Monoclonal Marmoset WB, ELISA MO58898W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO13387W
SpecificityThis antibody binds to Chimpanzee MDP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee MDP1 Antibody is a mouse antibody against MDP1. It can be used for MDP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMagnesium-dependent phosphatase 1; MDP1
UniProt IDK7B8V5
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRCYLHSHPEWNESSNSKSRVRDICEGPNWALRSSLEESPFEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry