Mouse Anti-PACRGL Antibody (MO-AB-22173W)


Cat: MO-AB-22173W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22173W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO22173W 100 µg
MO-AB-27709H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27709C 100 µg
MO-AB-60889W Monoclonal Marmoset WB, ELISA MO60889W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO22173W
SpecificityThis antibody binds to Chimpanzee PACRGL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee PACRGL Antibody is a mouse antibody against PACRGL. It can be used for PACRGL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPARK2 co-regulated-like; PACRGL
UniProt IDH2QZQ0
Protein RefseqThe length of the protein is 221 amino acids long.
The sequence is show below: MQKSEGSGGTQLKNRATGNYDQRTSSSTQIKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPFGEQSRAPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPCLNDHLKHLLTSGSLSIIKSKIPTYCSICC.
For Research Use Only | Not For Clinical Use.
Online Inquiry