Mouse Anti-PAXX Antibody (MO-AB-15151W)


Cat: MO-AB-15151W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15151W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO15151W 100 µg
MO-AB-17584R Monoclonal Cattle (Bos taurus) WB, ELISA MO17584R 100 µg
MO-AB-27738H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27738C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO15151W
SpecificityThis antibody binds to Chimpanzee PAXX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene plays a role in the nonhomologous end joining (NHEJ) pathway of DNA double-strand break repair. The encoded protein may function to stabilize the Ku70/Ku80 heterodimer to facilitate the assembly and maintain the stability of the NHEJ complex. (From NCBI)
Product OverviewMouse Anti-Chimpanzee PAXX Antibody is a mouse antibody against PAXX. It can be used for PAXX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 9 open reading frame 142; C9orf142
UniProt IDK7D5E9
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLQALTLGLAKRVWSLERRLAAAEETAVSPRKSPGPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET.
For Research Use Only | Not For Clinical Use.
Online Inquiry