AibGenesis™ Mouse Anti-PLAAT3 Antibody (MO-AB-22453W)


Cat: MO-AB-22453W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22453W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO22453W 100 µg
MO-AB-27916H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27916C 100 µg
MO-AB-28352R Monoclonal Pig (Sus scrofa) WB, ELISA MO28352R 100 µg
MO-AB-61644W Monoclonal Marmoset WB, ELISA MO61644W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO22453W
SpecificityThis antibody binds to Chimpanzee PLAAT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee PLAAT3 Antibody is a mouse antibody against PLAAT3. It can be used for PLAAT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhospholipase A2, group XVI; PLA2G16
UniProt IDK7BR37
Protein RefseqThe length of the protein is 162 amino acids long.
The sequence is show below: MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry