AibGenesis™ Mouse Anti-RNASE9 Antibody (MO-AB-20639W)


Cat: MO-AB-20639W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20639W Monoclonal Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Rat (Rattus norvegicus) WB, ELISA MO20639W 100 µg
MO-AB-28539H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28539C 100 µg
MO-AB-33089W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33089W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Rat (Rattus norvegicus)
CloneMO20639W
SpecificityThis antibody binds to Chimpanzee RNASE9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee RNASE9 Antibody is a mouse antibody against RNASE9. It can be used for RNASE9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInactive ribonuclease-like protein 9; Ribonuclease A K1; RNASE9; RAK1
UniProt IDH2Q7W6
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: MMRTLITTHPLPLLLLPQQLLQPVQFQEVDTDFDFPEEDKKEDFEEYLEQFFSTGPTRPPTKEKVKRRVLIESGMPLNHIEYCTHEIMGKNVYYKHHCVAEHYFLLMQYDELQKICYNRFVPCKNGIRKCNGSKGLVEGVYCNLTEAFEIPACKYESLYRKGYVLITCSWQNEMQKRIPHTINDLVEPPEHRSFLSEDGVFVIPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry