Mouse Anti-RNF122 Antibody (MO-AB-18635W)


Cat: MO-AB-18635W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18635W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO18635W 100 µg
MO-AB-19353R Monoclonal Cattle (Bos taurus) WB, ELISA MO19353R 100 µg
MO-AB-28546H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28546C 100 µg
MO-AB-38119W Monoclonal Goat (Capra hircus) WB, ELISA MO38119W 100 µg
MO-AB-63382W Monoclonal Marmoset WB, ELISA MO63382W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus)
CloneMO18635W
SpecificityThis antibody binds to Chimpanzee RNF122.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. (From NCBI)
Product OverviewMouse Anti-Chimpanzee RNF122 Antibody is a mouse antibody against RNF122. It can be used for RNF122 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRing finger protein 122; RNF122
UniProt IDH2R9V3
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV.
For Research Use Only | Not For Clinical Use.
Online Inquiry