Mouse Anti-RNF144A Antibody (MO-AB-25748W)


Cat: MO-AB-25748W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25748W Monoclonal Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO25748W 100 µg
MO-AB-63396W Monoclonal Marmoset WB, ELISA MO63396W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset
CloneMO25748W
SpecificityThis antibody binds to Chimpanzee RNF144A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development. (From NCBI)
Product OverviewMouse Anti-Chimpanzee RNF144A Antibody is a mouse antibody against RNF144A. It can be used for RNF144A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRing finger protein 144A; RNF144A
UniProt IDH2QHE3
Protein RefseqThe length of the protein is 292 amino acids long.
The sequence is show below: MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT.
For Research Use Only | Not For Clinical Use.
Online Inquiry