AibGenesis™ Mouse Anti-SHISAL1 Antibody (MO-AB-25651W)


Cat: MO-AB-25651W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25651W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO25651W 100 µg
MO-AB-28974H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28974C 100 µg
MO-AB-64358W Monoclonal Marmoset WB, ELISA MO64358W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO25651W
SpecificityThis antibody binds to Chimpanzee SHISAL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee SHISAL1 Antibody is a mouse antibody against SHISAL1. It can be used for SHISAL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKIAA1644
UniProt IDH2QLV5
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MTSCGQQSLNVLAVLFSLLFSAVLSAHFRVCEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYCCNETEFQAVMQANLTASSEGYMHNNYTALLGVWIYGFFVLMLLVLDLLYYSAMNYDICKVYLARWGIQGRWMKQDPRRWGNPARAPRPGQRTPQPQPPPGPLPQAPQAVHTLRGDAHSPPLMTFQSSSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry