AibGenesis™ Mouse Anti-SPACA5 Antibody (MO-AB-19010W)


Cat: MO-AB-19010W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19010W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO19010W 100 µg
MO-AB-29122H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29122C 100 µg
MO-AB-30361R Monoclonal Pig (Sus scrofa) WB, ELISA MO30361R 100 µg
MO-AB-65148W Monoclonal Marmoset WB, ELISA MO65148W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO19010W
SpecificityThis antibody binds to Chimpanzee SPACA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee SPACA5 Antibody is a mouse antibody against SPACA5. It can be used for SPACA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLysozyme E; SPACA5B; LYZE
UniProt IDH2QYJ5
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP.
For Research Use Only | Not For Clinical Use.
Online Inquiry