AibGenesis™ Mouse Anti-STATH Antibody (MO-AB-19086W)
Cat: MO-AB-19086W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-19086W | Monoclonal | Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO19086W | 100 µg | ||
| MO-AB-21027R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21027R | 100 µg | ||
| MO-AB-29249H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29249C | 100 µg | ||
| MO-AB-30494R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30494R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO19086W |
| Specificity | This antibody binds to Chimpanzee STATH. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Chimpanzee STATH Antibody is a mouse antibody against STATH. It can be used for STATH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Statherin; STATH |
| UniProt ID | H2QPL0 |
| Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYPF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry