AibGenesis™ Mouse Anti-TAS2R5 Antibody (MO-AB-20254W)


Cat: MO-AB-20254W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20254W Monoclonal Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO20254W 100 µg
MO-AB-35805W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35805W 100 µg
MO-AB-65862W Monoclonal Marmoset WB, ELISA MO65862W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset
CloneMO20254W
SpecificityThis antibody binds to Chimpanzee TAS2R5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a bitter taste receptor; bitter taste receptors are members of the G protein-coupled receptor superfamily and are specifically expressed by taste receptor cells of the tongue and palate epithelia. Each of these apparently intronless taste receptor genes encodes a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes on chromosome 7 and is genetically linked to loci that influence bitter perception. (From NCBI)
Product OverviewMouse Anti-Chimpanzee TAS2R5 Antibody is a mouse antibody against TAS2R5. It can be used for TAS2R5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTaste receptor type 2; TAS2R5
UniProt IDJ7M7K7
Protein RefseqThe length of the protein is 299 amino acids long.
The sequence is show below: MLSAGLGLLMLVAVVEFLIGLIGNGVLVVWSFREWIRKFSWSSYNLIILGLAGCRFVLQWLIILDLSLFPLFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDHPAYLWLKQRAYNLSLWCLLGYFIINLLLTVQIGLMFYHPPQGNSSIRYPFESWQYLYAFRLNSGSYLPLMVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVRAKAHITALKSLGCFLLLHLVYIMASPFSIASKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPSVKQTCQKILWKTVCARRCWGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry