AibGenesis™ Mouse Anti-THAP2 Antibody (MO-AB-21951W)


Cat: MO-AB-21951W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21951W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO21951W 100 µg
MO-AB-29440H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29440C 100 µg
MO-AB-66133W Monoclonal Marmoset WB, ELISA MO66133W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO21951W
SpecificityThis antibody binds to Chimpanzee THAP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee THAP2 Antibody is a mouse antibody against THAP2. It can be used for THAP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHAP domain containing, apoptosis associated protein 2; THAP2
UniProt IDH2Q6H0
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRRLKMDAVPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI.
For Research Use Only | Not For Clinical Use.
Online Inquiry