AibGenesis™ Mouse Anti-TMEM81 Antibody (MO-AB-19585W)


Cat: MO-AB-19585W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19585W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset WB, ELISA MO19585W 100 µg
MO-AB-21905R Monoclonal Cattle (Bos taurus) WB, ELISA MO21905R 100 µg
MO-AB-66552W Monoclonal Marmoset WB, ELISA MO66552W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset
CloneMO19585W
SpecificityThis antibody binds to Chimpanzee TMEM81.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee TMEM81 Antibody is a mouse antibody against TMEM81. It can be used for TMEM81 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 81; TMEM81
UniProt IDH2RH33
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIISATTCTVTCGLGYKEETVCEVGPDGVRRKCQTQRLECLTNWICGMLHFTILIGKEFELSCLSSDILEFGQEAFRFTWRLARGVISTDDEVFKPFQANSHFVKFKYAQEYDSGTYRCDVQLVKNLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIAIGVVGGVLVRIVLCALRGGLQR.
For Research Use Only | Not For Clinical Use.
Online Inquiry