AibGenesis™ Mouse Anti-ZNF22 Antibody (MO-AB-22681W)


Cat: MO-AB-22681W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22681W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO22681W 100 µg
MO-AB-23257R Monoclonal Cattle (Bos taurus) WB, ELISA MO23257R 100 µg
MO-AB-30136H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30136C 100 µg
MO-AB-68370W Monoclonal Marmoset WB, ELISA MO68370W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO22681W
SpecificityThis antibody binds to Chimpanzee ZNF22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBinds DNA through the consensus sequence 5-CAATG-3. May be involved in transcriptional regulation and may play a role in tooth formation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Chimpanzee ZNF22 Antibody is a mouse antibody against ZNF22. It can be used for ZNF22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 22 (KOX 15); ZNF22
UniProt IDH2Q1U7
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry