AibGenesis™ Mouse Anti-BBR / BPC2 Antibody (MO-AB-27249W)


Cat: MO-AB-27249W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-27249W Monoclonal Cottonwood (Populus deltoids), Grape (Vitis vinifera) WB, ELISA MO27249W 100 µg
MO-AB-38864W Monoclonal Grape (Vitis vinifera) WB, ELISA MO38864W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCottonwood (Populus deltoids), Grape (Vitis vinifera)
CloneMO27249W
SpecificityThis antibody binds to Cottonwood BBR / BPC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cottonwood BBR / BPC2 Antibody is a mouse antibody against BBR / BPC2. It can be used for BBR / BPC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGAGA-motif binding transcriptional activator; BBR / BPC2
UniProt IDA8D1A0
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: MDDDALNMRNWGYYEPSYKEPLGLQLMPAMVDRDSKHLLPRRDPNNIMVGATGAYLPRDSLVSDASMHMNYMRDSWINREKYLNMLPPNPSYVVHPETSGAQSMPMLQPPDSSRDERVSRMEEPSVSKEGSQLKKRQVGGTAPKTPKPKKPRKPKDGNNNTVQRAKPAKKSVDVVINGIDMDISGIPIPVCSCTGIPQQCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRTHWARHGTNKFVTIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry