Mouse Anti-Anp32A Antibody (CBMOAB-01046FYA)
Cat: CBMOAB-01046FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-01046FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset | WB, ELISA | MO01046FYA | 100 µg | ||
| CBMOAB-35863FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO35863FYA | 100 µg | ||
| CBMOAB-65930FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65930FYA | 100 µg | ||
| MO-AB-07391R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07391R | 100 µg | ||
| MO-AB-16369W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16369W | 100 µg | ||
| MO-AB-24080H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24080C | 100 µg | ||
| MO-AB-28956W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28956W | 100 µg | ||
| MO-AB-50932W | Monoclonal | Marmoset | WB, ELISA | MO50932W | 100 µg | ||
| MO-DKB-01173W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset |
| Clone | MO01046FYA |
| Specificity | This antibody binds to fruit fly Anp32A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression. |
| Product Overview | Mouse Anti-D. melanogaster Anp32A Antibody is a mouse antibody against Anp32A. It can be used for Anp32A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Acidic leucine-rich nuclear phosphoprotein 32 family member A; Anp32a; Mapmodulin |
| UniProt ID | Q9V895 |
| Protein Refseq | The length of the protein is 261 amino acids long. The sequence is show below: MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGNDSDEVGVSDEDDDSDDSDEEANGEVSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKDKDGEKEADESQVRGKKRKHDG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry