Mouse Anti-Asp Antibody (CBMOAB-01285FYA)


Cat: CBMOAB-01285FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01285FYA Monoclonal Fruit fly (Drosophila melanogaster), Sheep (Ovis aries), Silkworm (Bombyx mori) WB, ELISA MO01285FYA 100 µg
MO-AB-02233W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02233W 100 µg
MO-AB-14269Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14269Y 100 µg
MO-AB-68837W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO68837W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Sheep (Ovis aries), Silkworm (Bombyx mori)
CloneMO01285FYA
SpecificityThis antibody binds to fruit fly Asp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired to maintain the structure of the centrosomal microtubule organizing center (MTOC) during mitosis. May have a preferential role in regulating neurogenesis. Required for germ cell mitosis and oocyte differentiation.
Product OverviewMouse Anti-D. melanogaster Asp Antibody is a mouse antibody against Asp. It can be used for Asp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbnormal spindle; Fragment; asp
UniProt IDB6UW25
Protein RefseqThe length of the protein is 322 amino acids long.
The sequence is show below: MSAFEITVTPSRLKQKKRAEGREPAVVVMAPFSAKAIVQFEDVPITKTARRQVRVLNPSDDDIEVKVMKAIREEHNLSLEWMEHTVPARDEVSMELVWSPVLEVACKETLQLIDNRNFRKEVMIILKSKSNQPVKNPRKFPTVGKTLQLKSPTGAGKTMKSVVSAAVQQKKRMSAAAAPPSKQTWRVTATSRPAARAHPPPQAPLVEKNVYKTPQEEPVYISPQPRSLKENLSPMTPGNLLDVIDNLRFTPLTETRGKGQATIFPDNLAAWPTPTLKGNSKPCANDMRPRRXTPDDLEDQPATNKTFDVKHSETINISLDTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry