AibGenesis™ Mouse Anti-Bace Antibody (CBMOAB-02141FYA)


Cat: CBMOAB-02141FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02141FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Purple sea urchin (Strongylocentrotus purpuratus) WB, ELISA MO02141FYA 100 µg
MO-AB-00256Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00256Y 100 µg
MO-AB-30581H Monoclonal Purple sea urchin (Strongylocentrotus purpuratus) WB, ELISA MO30581C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Purple sea urchin (Strongylocentrotus purpuratus)
CloneMO02141FYA
SpecificityThis antibody binds to fruit fly Bace.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Bace Antibody is a mouse antibody against Bace. It can be used for Bace detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-site APP-cleaving enzyme, isoform A; EC 3.4.23.-; Beta-site APP-cleaving enzyme, isoform B; EC 3.4.23.-; GH11417p; Bace
UniProt IDQ9VLK3
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MFKTIAVVVLLAALASAELHRVPILKEQNFVKTRQNVLAEKSYLRTKYQLPSLRSVDEEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCKSDACLTHNQYDSSASSTYVANGESFSIQYGTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAPPFYNMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGYWQFTMAGSSIDGYSLCDDCQAIADTGTSLIVAPYNAYITLSEILNVGEDGYLDCSSVSSLPDVTFNIGGTNFVLKPSAYIIQSDGNCMSAFEYMGTDFWILGDVFIGQYYTEFDLGNNRIGFAPVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry