AibGenesis™ Mouse Anti-Baf Antibody (CBMOAB-02142FYA)


Cat: CBMOAB-02142FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02142FYA Monoclonal Fruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO02142FYA 100 µg
MO-AB-10722Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10722Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss)
CloneMO02142FYA
SpecificityThis antibody binds to fruit fly Baf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Baf Antibody is a mouse antibody against Baf. It can be used for Baf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBarrier to autointegration factor, isoform B; baf
UniProt IDM9PCH8
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry