AibGenesis™ Mouse Anti-Beaf-32 Antibody (CBMOAB-02290FYA)


Cat: CBMOAB-02290FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02290FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO02290FYA 100 µg
MO-NAB-00699W Monoclonal D. melanogaster (Drosophila melanogaster) ChIP, IHC, IP, WB NW0621 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO02290FYA
SpecificityThis antibody binds to fruit fly Beaf-32.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Beaf-32 Antibody is a mouse antibody against Beaf-32. It can be used for Beaf-32 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBoundary element associated factor; Boundary element-associated factor of 32kD, isoform A; BEAF-32; BEAF-32A
UniProt IDQ7JN06
Protein RefseqThe length of the protein is 283 amino acids long.
The sequence is show below: MHVEKKSELRSLLKSGDKRCKLVEPRNTKSCVWRFFNLVQCDDHIEPYACCKTCGDLLSYSGKTGTGSLLRHRCLHSSSSNDKTVRITKAKTLREPLRVAKPKIESNVANYLGEAGALPQKWEEYEQNDEISEDIKDIIYSEDPLCYSPIHVMDDEGLDQPEKQVTVLTHSTSPAGGSSRPIGVGSGVQATVVASTSSSSSSAKQLKNNLETSIERLTAVSEQLSYIIQQNHEELTKDDDYYFALSLVPAMRHLSLSRKMYVRSKIQDILFKESEDSTLAKDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry