Mouse Anti-Bhd Antibody (CBMOAB-02492FYA)


Cat: CBMOAB-02492FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02492FYA Monoclonal Fruit fly (Drosophila melanogaster), Dog (Canis lupus familiaris) WB, ELISA MO02492FYA 100 µg
MO-AB-29245W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29245W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Dog (Canis lupus familiaris)
CloneMO02492FYA
SpecificityThis antibody binds to fruit fly Bhd.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Bhd Antibody is a mouse antibody against Bhd. It can be used for Bhd detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBirt-Hogg-Dube homolog; IP07113p; SD02418p; BHD; CG8616-RA
UniProt IDQ9VS33
Protein RefseqThe length of the protein is 460 amino acids long.
The sequence is show below: MNAVIALCHFCEAHGPCAIFCTQTLRDTKLEDLSLEQQTQKTCSACNYSMGKNNNAIYSRDTESGATFVSTKVAVLPEVASLVKQAAVLSLSNGTDASKDGEFVFFGDSSRGHILSHTFRVSDLQARGYSQLFSIIVLMKDKYFLLNIKPFLAEHLKKVSSELQAAAKKTKETEEQTYSERQRRLSGAQFLMPTSRALLELTGEEHIFAQLHSHFSWLLLAGSRFLTEHVTFGNLPWLPPQSSGRPPAQRLTYNSSTLPMIESIDDPDLEEFFSLRHLKSVVRKEEFATVCYCALTGVKIVVRGDPRKTFRFMVCLKKLLPEPMHNLMRIDAQHQHSISSEYKIISVSNDIAVPMASSSVYRIDFLDKHVNGHEVSVKWPGELPRKLPDLMVKLLKAVEEKNFTELVLNKQTKVLIEEWKNKVTCLNHAKSTSVQGKLKKVLGVQPHDQPIINYWSTHLH.
For Research Use Only | Not For Clinical Use.
Online Inquiry