Mouse Anti-Ccdc56 Antibody (CBMOAB-03177FYA)


Cat: CBMOAB-03177FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03177FYA Monoclonal Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rhesus (Macaca mulatta) WB, ELISA MO03177FYA 100 µg
CBMOAB-38438FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO38438FYA 100 µg
MO-AB-02142H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02142C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rhesus (Macaca mulatta)
CloneMO03177FYA
SpecificityThis antibody binds to fruit fly Ccdc56.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Ccdc56 Antibody is a mouse antibody against Ccdc56. It can be used for Ccdc56 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase assembly factor 3, mitochondrial; Coiled-coil domain-containing protein 56 homolog; Ccdc56
UniProt IDP0DKM0
Protein RefseqThe length of the protein is 87 amino acids long.
The sequence is show below: MSASEQGPKIKYGESAPKLDKAQLQFMKLIEEQNLDRVQKLKRIRRNNLLTAGALGVSVLAIYGYSIFSVQQEKFLDDFEEPKKVSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry