AibGenesis™ Mouse Anti-Ccdc56 Antibody (CBMOAB-03177FYA)
Cat: CBMOAB-03177FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-03177FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rhesus (Macaca mulatta) | WB, ELISA | MO03177FYA | 100 µg | ||
| CBMOAB-38438FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38438FYA | 100 µg | ||
| MO-AB-02142H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02142C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rhesus (Macaca mulatta) |
| Clone | MO03177FYA |
| Specificity | This antibody binds to fruit fly Ccdc56. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-D. melanogaster Ccdc56 Antibody is a mouse antibody against Ccdc56. It can be used for Ccdc56 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome c oxidase assembly factor 3, mitochondrial; Coiled-coil domain-containing protein 56 homolog; Ccdc56 |
| UniProt ID | P0DKM0 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MSASEQGPKIKYGESAPKLDKAQLQFMKLIEEQNLDRVQKLKRIRRNNLLTAGALGVSVLAIYGYSIFSVQQEKFLDDFEEPKKVSS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry