AibGenesis™ Mouse Anti-Cecb Antibody (CBMOAB-03298FYA)


Cat: CBMOAB-03298FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-03298FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti) WB, ELISA MO03298FYA 100 µg
MO-AB-05182Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05182Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti)
CloneMO03298FYA
SpecificityThis antibody binds to fruit fly Cecb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Cecb Antibody is a mouse antibody against Cecb. It can be used for Cecb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCecropin-B; CecB
UniProt IDP14956
Protein RefseqThe length of the protein is 63 amino acids long.
The sequence is show below: MNFNKIFVFVALILAISLGNSEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG.
For Research Use Only | Not For Clinical Use.
Online Inquiry