AibGenesis™ Mouse Anti-Cox7A Antibody (CBMOAB-13816FYA)


Cat: CBMOAB-13816FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-13816FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO13816FYA 100 µg
Inquiry
MO-AB-02394W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02394W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO13816FYA
SpecificityThis antibody binds to fruit fly Cox7A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Cox7A Antibody is a mouse antibody against Cox7A. It can be used for Cox7A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRE30055p; COX7A
UniProt IDQ8SYW9
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: MMNLSRAVVRSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKGRQARLPQGIRRGQRALPRHRRSRPRRHRWHGQAFLRAECSQEGVKSQYRTLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry