Mouse Anti-Creg Antibody (CBMOAB-14131FYA)


Cat: CBMOAB-14131FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-14131FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO14131FYA 100 µg
MO-AB-01407Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01407Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO14131FYA
SpecificityThis antibody binds to fruit fly Creg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Creg Antibody is a mouse antibody against Creg. It can be used for Creg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCellular repressor of E1A-stimulated genes, isoform A; Cellular repressor of E1A-stimulated genes, isoform B; GH28782p; CREG
UniProt IDQ9VEK7
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MKTFHSLLFALILALVSLDPSSGYSRRKDERIIREYKREQELNHAKIARDLVHRANWAAVGSLSTNERVKGYPMVNIISIDDSDANNRSTGRIRFLLTDLDFTGPDWQKDNKVTLLFSDEQTLRCKEGGKDPMEPTCARSMISGQVKKMDPSDKSYQPSLDAYVRRHPAAINWVKAHNFYLCELEISNIFVLDFYGGPHKVSASDYYAVSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry