AibGenesis™ Mouse Anti-Dpt Antibody (CBMOAB-15133FYA)


Cat: CBMOAB-15133FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15133FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO15133FYA 100 µg
CBMOAB-41162FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO41162FYA 100 µg
CBMOAB-74060FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74060FYA 100 µg
MO-AB-11644R Monoclonal Cattle (Bos taurus) WB, ELISA MO11644R 100 µg
MO-AB-15028W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15028W 100 µg
MO-AB-25482H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25482C 100 µg
MO-AB-30572W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30572W 100 µg
MO-AB-54478W Monoclonal Marmoset WB, ELISA MO54478W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO15133FYA
SpecificityThis antibody binds to fruit fly Dpt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Dpt Antibody is a mouse antibody against Dpt. It can be used for Dpt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDiptericin; Dpt; Dipt
UniProt IDP24492
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: MQFTIAVALLCCAIASTLAYPMPDDMTMKPTPPPQYPLNLQGGGGGQSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry