AibGenesis™ Mouse Anti-Fibp Antibody (CBMOAB-16811FYA)


Cat: CBMOAB-16811FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16811FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset WB, ELISA MO16811FYA 100 µg
MO-AB-03609H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03609C 100 µg
MO-AB-12575R Monoclonal Cattle (Bos taurus) WB, ELISA MO12575R 100 µg
MO-AB-25658W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25658W 100 µg
MO-AB-37206W Monoclonal Goat (Capra hircus) WB, ELISA MO37206W 100 µg
MO-AB-55479W Monoclonal Marmoset WB, ELISA MO55479W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset
CloneMO16811FYA
SpecificityThis antibody binds to fruit fly Fibp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAcidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenic action of aFGF. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Fibp Antibody is a mouse antibody against Fibp. It can be used for Fibp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAFGF intracellular binding protein; Fibp
UniProt IDQ8WR20
Protein RefseqThe length of the protein is 358 amino acids long.
The sequence is show below: MADVDVFISNYAIIDPEIYQLWIEGFSSSEAVSYLKQKGFGHSMGAPSDLIASDVLDHYRTYSLIELYLNAPTKLMEQSCFQLEPQMRDLITEKYYSIDDVVAREILGKKLSSRYRKDLDEVAEKTCVKLKSVRRQFDNVKRIFKAVEEMPGTLTNNIKQHFIISTDLAKKYACIVFLACLRFETTKKKLQYLSFSDLLTCSHAIMIYWTYTYQHTGPEYYDTEMDKEFLLDLRELRCLLDKEKEIKHLVCMRLKPVLLERAFHELDGNFRSYWRALITIACNLHRNRELRDLFVDLCEKLIDPWRQNGWNREQVNKFLASITQSVLDLEISRDQETRCLWDRYMQVITICLDKMYHI.
For Research Use Only | Not For Clinical Use.
Online Inquiry