AibGenesis™ Mouse Anti-Gie Antibody (CBMOAB-17632FYA)


Cat: CBMOAB-17632FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-17632FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO17632FYA 100 µg
MO-NAB-00719W Polyclonal D. melanogaster (Drosophila melanogaster) IF, IHC, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO17632FYA
SpecificityThis antibody binds to fruit fly Gie.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for normal functioning of the late endocytic pathway including lysosome motility and late endosome-lysosome fusion (PubMed:16537643, PubMed:29940804, PubMed:30115618). Not required for the delivery of lysosomal membrane protein-containing vesicles to late endosomes (PubMed:29940804). In larval motorneurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (PubMed:30174114, PubMed:30115618). Essential role in chromosome segregation (PubMed:15331635). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Gie Antibody is a mouse antibody against Gie. It can be used for Gie detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP-ribosylation factor-like protein 8; Novel small G protein indispensable for equal chromosome segregation; dGie; Gie; Arl8
UniProt IDQ9VHV5
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry