Mouse Anti-Got2 Antibody (CBMOAB-17943FYA)


Cat: CBMOAB-17943FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-17943FYA Monoclonal Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO17943FYA 100 µg
CBMOAB-43841FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO43841FYA 100 µg
MO-AB-00572L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00572L 100 µg
MO-AB-00622R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00622R 100 µg
MO-AB-02192Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02192Y 100 µg
MO-AB-03994H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03994C 100 µg
MO-AB-07963W Monoclonal Cat (Felis catus) WB, ELISA MO07963W 100 µg
MO-AB-08248Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08248Y 100 µg
MO-AB-12615W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12615W 100 µg
MO-AB-13227R Monoclonal Cattle (Bos taurus) WB, ELISA MO13227R 100 µg
MO-AB-15575Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15575Y 100 µg
MO-AB-23263H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23263C 100 µg
MO-AB-33267H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33267C 100 µg
MO-AB-44922W Monoclonal Horse (Equus caballus) WB, ELISA MO44922W 100 µg
MO-AB-56199W Monoclonal Marmoset WB, ELISA MO56199W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO17943FYA
SpecificityThis antibody binds to fruit fly Got2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGlutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-D. melanogaster Got2 Antibody is a mouse antibody against Got2. It can be used for Got2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAspartate aminotransferase; EC 2.6.1.1; Got2; Got2-RB
UniProt IDQ8IPY3
Protein RefseqThe length of the protein is 431 amino acids long.
The sequence is show below: MSRTIIMTLKDIVHVWSNDPGERMCRANRVSTWFSEVQMGPPDAILGVTEAFKKDTNPKKINLGAGAYRDDNTQPFVLPSVREAEKRVVSRSLDKEYATIIGIPEFYNKAIELALGKGSKRLAAKHNVTAQSISGTGALRIGAAFLAKFWQGNREIYIPSPSWGNHVAIFEHAGLPVNRYRYYDKDTCALDFGGLIEDLKKIPEKSIVLLHACAHNPTGVDPTLEQWREISALVKKRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVLCSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDVRTKLKDNLIKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGVTSKNVEYLAESIHKVTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry