Mouse Anti-Got2 Antibody (CBMOAB-17943FYA)
Cat: CBMOAB-17943FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-17943FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO17943FYA | 100 µg | ||
CBMOAB-43841FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43841FYA | 100 µg | ||
MO-AB-00572L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00572L | 100 µg | ||
MO-AB-00622R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00622R | 100 µg | ||
MO-AB-02192Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02192Y | 100 µg | ||
MO-AB-03994H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03994C | 100 µg | ||
MO-AB-07963W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07963W | 100 µg | ||
MO-AB-08248Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08248Y | 100 µg | ||
MO-AB-12615W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12615W | 100 µg | ||
MO-AB-13227R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13227R | 100 µg | ||
MO-AB-15575Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15575Y | 100 µg | ||
MO-AB-23263H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23263C | 100 µg | ||
MO-AB-33267H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33267C | 100 µg | ||
MO-AB-44922W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44922W | 100 µg | ||
MO-AB-56199W | Monoclonal | Marmoset | WB, ELISA | MO56199W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
Clone | MO17943FYA |
Specificity | This antibody binds to fruit fly Got2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-D. melanogaster Got2 Antibody is a mouse antibody against Got2. It can be used for Got2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Aspartate aminotransferase; EC 2.6.1.1; Got2; Got2-RB |
UniProt ID | Q8IPY3 |
Protein Refseq | The length of the protein is 431 amino acids long. The sequence is show below: MSRTIIMTLKDIVHVWSNDPGERMCRANRVSTWFSEVQMGPPDAILGVTEAFKKDTNPKKINLGAGAYRDDNTQPFVLPSVREAEKRVVSRSLDKEYATIIGIPEFYNKAIELALGKGSKRLAAKHNVTAQSISGTGALRIGAAFLAKFWQGNREIYIPSPSWGNHVAIFEHAGLPVNRYRYYDKDTCALDFGGLIEDLKKIPEKSIVLLHACAHNPTGVDPTLEQWREISALVKKRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVLCSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDVRTKLKDNLIKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGVTSKNVEYLAESIHKVTK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry