AibGenesis™ Mouse Anti-Gs1 Antibody (CBMOAB-18252FYA)


Cat: CBMOAB-18252FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18252FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti), Arabidopsis (Arabidopsis lyrata), Cucumber (Cucumis sativus) WB, ELISA MO18252FYA 100 µg
MO-AB-00550H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00550C 100 µg
MO-AB-05891Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05891Y 100 µg
MO-AB-28479W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28479W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti), Arabidopsis (Arabidopsis lyrata), Cucumber (Cucumis sativus)
CloneMO18252FYA
SpecificityThis antibody binds to fruit fly Gs1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Gs1 Antibody is a mouse antibody against Gs1. It can be used for Gs1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutamine synthetase 1, mitochondrial; EC 6.3.1.2; Glutamate--ammonia ligase 1; Gs1
UniProt IDP20477
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MALRVAGLFLKKELVAPATQQLRLLRTGNTTRSQFLANSPNTALDKSILQRYRNLETPANRVQATYLWIDGTGENIRLKDRVLDKVPSSVEDLPDWQYDGSSTYQAHGENSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGKPTASNKRAAFQAAIDLISDQEPWFGIEQEYTLLDVDGRPFGWPENGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTNAEVMPAQWEFQIGPAGIKACDDLWVSRYILQRIAEEYGVVVTFDPKPMEGQWNGAGAHTNFSTKEMRADGGIKAIEEAIEKLSKRHERHIKAYDPKEGKDNERRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKGYLEDRRPSSNCDPYAVCNAIVRTCLLNE.
For Research Use Only | Not For Clinical Use.
Online Inquiry