AibGenesis™ Mouse Anti-Gs2 Antibody (CBMOAB-18256FYA)


Cat: CBMOAB-18256FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18256FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti), Barrel medic (Medicago truncatula) WB, ELISA MO18256FYA 100 µg
MO-AB-00223W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00223W 100 µg
MO-AB-02659W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02659W 100 µg
MO-AB-05892Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05892Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti), Barrel medic (Medicago truncatula)
CloneMO18256FYA
SpecificityThis antibody binds to fruit fly Gs2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Gs2 Antibody is a mouse antibody against Gs2. It can be used for Gs2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutamine synthetase; EC 6.3.1.2; Gs2
UniProt IDX2JDA5
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MHSAMSARILEDSPNARINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry