AibGenesis™ Mouse Anti-Hug Antibody (CBMOAB-20859FYA)


Cat: CBMOAB-20859FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-20859FYA Monoclonal Fruit fly (Drosophila melanogaster), Zebrafish (Danio rerio) WB, ELISA MO20859FYA 100 µg
CBMOAB-80177FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80177FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Zebrafish (Danio rerio)
CloneMO20859FYA
SpecificityThis antibody binds to fruit fly Hug.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Hug Antibody is a mouse antibody against Hug. It can be used for Hug detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein hugin; [Cleaved into: Hug-gamma; Hug-peptide; PK-2 (Drm-PK-2) (Myotrophin-2) (Drm-MT2) (MT-2) (Pyrokinin-2)]; Hug
UniProt IDQ9VG55
Protein RefseqThe length of the protein is 191 amino acids long.
The sequence is show below: MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSPASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQEFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAEGATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry