AibGenesis™ Mouse Anti-Lsm11 Antibody (CBMOAB-23323FYA)


Cat: CBMOAB-23323FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23323FYA Monoclonal Fruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO23323FYA 100 µg
CBMOAB-49292FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO49292FYA 100 µg
CBMOAB-85559FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85559FYA 100 µg
MO-AB-04926H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04926C 100 µg
MO-AB-15909W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15909W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO23323FYA
SpecificityThis antibody binds to fruit fly Lsm11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Lsm11 Antibody is a mouse antibody against Lsm11. It can be used for Lsm11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSD11312p; Lsm11
UniProt IDQ8MRZ3
Protein RefseqThe length of the protein is 256 amino acids long.
The sequence is show below: MESRDRKTSNEDDSSEISELDVGSDRFNPLRALYEPNFRVTDAVPKVIYQNLAAFESALKKFGIWQLNKRQKPGSAEGGDQGTSKKASTSEAVDILPPERRFEPHQMPTTSSRKKHHRNIFTYMEAAVGPLELLTKCISPASHNESNERIRVRVVIRKHGSVGGSVEGELLAFDKQWNLLLRNVTETWKRRKYNYGEQNICDTPVDCTGRLKELGITLPRTVVKNLNRKNVEIRRELPQILIRGENVVLVSLIPTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry