Mouse Anti-Mis12 Antibody (CBMOAB-24329FYA)


Cat: CBMOAB-24329FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24329FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset WB, ELISA MO24329FYA 100 µg
CBMOAB-06634HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06634HB 100 µg
MO-AB-59129W Monoclonal Marmoset WB, ELISA MO59129W 100 µg
MO-AB-15815R Monoclonal Cattle (Bos taurus) WB, ELISA MO15815R 100 µg
MO-DKB-02628W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset
CloneMO24329FYA
SpecificityThis antibody binds to fruit fly Mis12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMIS12 (MIS12, Kinetochore Complex Component) is a Protein Coding gene. Among its related pathways are Signaling by Rho GTPases and Cell Cycle, Mitotic.
Product OverviewMouse Anti-D. melanogaster Mis12 Antibody is a mouse antibody against Mis12. It can be used for Mis12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG18156-PA; RE19545p; Mis12
UniProt IDQ9VS01
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MDFNSLAYDQKFFNFTAAQLSAEREHIVQDIIKKGIGQIIDKIKTPATAELLEAEKETVERRFQASASKGLKALRELDSKVFHVPPHVLHPEHMFVENQYTSEEEEQKTARLEELKAKYRENMAMLAHLKIEEEKYAAMEDLIQKEIEMQDRVQRSCSSLNITKLKQFWNQVPLQIKKETD.
For Research Use Only | Not For Clinical Use.
Online Inquiry