Mouse Anti-mis12 Antibody (MO-AB-05188H)


Cat: MO-AB-05188H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05188H Monoclonal Frog (Xenopus laevis), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset WB, ELISA MO05188C 100 µg
CBMOAB-06634HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06634HB 100 µg
MO-AB-59129W Monoclonal Marmoset WB, ELISA MO59129W 100 µg
MO-AB-15815R Monoclonal Cattle (Bos taurus) WB, ELISA MO15815R 100 µg
MO-DKB-02628W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Marmoset
CloneMO05188C
SpecificityThis antibody binds to Frog mis12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMIS12 (MIS12, Kinetochore Complex Component) is a Protein Coding gene. Among its related pathways are Signaling by Rho GTPases and Cell Cycle, Mitotic.
Product OverviewThis product is a mouse antibody against mis12. It can be used for mis12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC80789 protein; mis12; MGC80789
UniProt IDQ6GNY3
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MCYESQLFEFTPQTCILRVYIAFQDYLFEMVLVVEKVIMKKLESMQGNKISHFRVRQSTEKYLHFMRERFNFLFQKMETFLLNLVLSIPSNVLLLEDKVHSQYSYSKEEFEHLQAETENLEKKCKAETLATQRLLAELEEQKHVQAELEKILTWFKGLDKICREHGNIDLKESFGFMTQTTRKLQDTVTEIDMKHKKTKVDGSTLTPICPRNRKGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry