Mouse Anti-D. melanogaster Mt-Nd4 Antibody (CBMOAB-25320FYA)


Cat: CBMOAB-25320FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO25320FYA
SpecificityThis antibody binds to fruit fly Mt-Nd4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCore subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Product OverviewMouse Anti-D. melanogaster Mt-Nd4 Antibody is a mouse antibody against Mt-Nd4. It can be used for Mt-Nd4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADH-ubiquinone oxidoreductase chain 4; EC 1.6.5.3; Fragment
UniProt IDM4N8B8
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: INKHNNYKNLFLLNIIILLLLLILTFSSMSLFMFYLFFESSLIPTLFLILGWGYQPERLQAGLYLLFYTLLVSLPMLIGIFYVMNKIGSMNFYLMNNFMFNYDLLYFCLLCAFLVKMPMFLVHLWLPKAHVEAPVSGSMILAGIMLKLGGYGM.
See other products for " MT-ND4 "
MO-AB-08890YMouse Anti-Rabbit MT-ND4 Antibody (MO-AB-08890Y)
MO-AB-00829LMouse Anti-Elephant MT-ND4 Antibody (MO-AB-00829L)
MO-AB-31844WMouse Anti-Dog MT-ND4 Antibody (MO-AB-31844W)
MO-AB-08696WMouse Anti-Cat MT-ND4 Antibody (MO-AB-08696W)
MO-AB-16182RMouse Anti-Cattle MT-ND4 Antibody (MO-AB-16182R)
MO-AB-45580WMouse Anti-Horse MT-ND4 Antibody (MO-AB-45580W)
MO-AB-34274WMouse Anti-Donkey MT-ND4 Antibody (MO-AB-34274W)
CBMOAB-87736FYAMouse Anti-Zebrafish mt-nd4 Antibody (CBMOAB-87736FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry