AibGenesis™ Mouse Anti-Nlp Antibody (CBMOAB-25729FYA)


Cat: CBMOAB-25729FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25729FYA Monoclonal Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Soybean (Glycine max) WB, ELISA MO25729FYA 100 µg
MO-AB-05659H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05659C 100 µg
MO-AB-32116H Monoclonal Soybean (Glycine max) WB, ELISA MO32116C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Soybean (Glycine max)
CloneMO25729FYA
SpecificityThis antibody binds to fruit fly Nlp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Nlp Antibody is a mouse antibody against Nlp. It can be used for Nlp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNucleoplasmin-like protein; Chromatin decondensation protein 1; dNLP; Nlp; CRP1
UniProt IDQ27415
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: MAEESFYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDMEEDDEEDDVAEDEEDEHPKKRAKIENAADGKNAKNNKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry