AibGenesis™ Mouse Anti-Nrv1 Antibody (CBMOAB-25930FYA)


Cat: CBMOAB-25930FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25930FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Insects WB, ELISA MO25930FYA 100 µg
MO-NAB-00814W Monoclonal D. melanogaster (Drosophila melanogaster), Insects IF, IHC, WB NW0736 100 µg
MO-DKB-00542W Polyclonal Fruit fly (Drosophila melanogaster) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Insects
CloneMO25930FYA
SpecificityThis antibody binds to fruit fly Nrv1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Nrv1 Antibody is a mouse antibody against Nrv1. It can be used for Nrv1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSodium/potassium-transporting ATPase subunit beta-1; Protein nervana 1; Sodium/potassium-dependent ATPase subunit beta-1; nrv1
UniProt IDQ24046
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: MSKNNGKGAKGEFEFPQPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGFGQVLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGFPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD.
For Research Use Only | Not For Clinical Use.
Online Inquiry