AibGenesis™ Mouse Anti-Nullo Antibody (CBMOAB-26024FYA)


Cat: CBMOAB-26024FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-26024FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO26024FYA 100 µg
MO-NAB-00816W Monoclonal D. melanogaster (Drosophila melanogaster) IF, IHC, WB NW0738 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO26024FYA
SpecificityThis antibody binds to fruit fly Nullo.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Nullo Antibody is a mouse antibody against Nullo. It can be used for Nullo detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein nulloo
UniProt IDP32845
Protein RefseqThe length of the protein is 213 amino acids long.
The sequence is show below: MGSTHSAEKVKSVEDSTSPANPGIFCTPLPGFISNIQRLVLRKLSISARKQKRLNKRSKHLLRPMPRCSSFGSCGTLLTPTKKSASNIADRRYAQWKCSFEHLAQKQPRLHDISEAMTGQTTPRGFPSHTDPKRCLMVMDSSSPESPLYDMVGGQKVRRRLSLRSHALVRRPSARQKAEQAKLDAQFQRDLRDLEDYYGGFHFAQRRERLVKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry