Mouse Anti-Paip2 Antibody (CBMOAB-27127FYA)


Cat: CBMOAB-27127FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27127FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) WB, ELISA MO27127FYA 100 µg
MO-AB-12712Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12712Y 100 µg
MO-AB-17505R Monoclonal Cattle (Bos taurus) WB, ELISA MO17505R 100 µg
MO-AB-19036W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19036W 100 µg
MO-AB-27715H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27715C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus)
CloneMO27127FYA
SpecificityThis antibody binds to fruit fly Paip2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Paip2 Antibody is a mouse antibody against Paip2. It can be used for Paip2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD15606p; MIP08219p; PolyA-binding protein interacting protein 2; PolyA-binding protein-interacting protein 2; Paip2; Paip2-RA
UniProt IDQ9VG13
Protein RefseqThe length of the protein is 124 amino acids long.
The sequence is show below: MLLKVPSVDWTDQIIYVVDDDESLSDIDDEPDFSEYMWMENEEEFDKNELQRLEEEEIMQECFEAMIEDELEEQINEWEKAKTDEQNTALSALPKSQCDVEKSVLNPMADEFVPRCHVIDFPAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry