Mouse Anti-D. melanogaster Paip2 Antibody (CBMOAB-27127FYA)


Cat: CBMOAB-27127FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO27127FYA
SpecificityThis antibody binds to fruit fly Paip2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. Displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP1 for binding to PABPC1. Its association with PABPC1 results in disruption of the cytoplasmic poly(A) RNP structure organization.
Product OverviewMouse Anti-D. melanogaster Paip2 Antibody is a mouse antibody against Paip2. It can be used for Paip2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD15606p; MIP08219p; PolyA-binding protein interacting protein 2; PolyA-binding protein-interacting protein 2; Paip2; Paip2-RA
UniProt IDQ9VG13
Protein RefseqThe length of the protein is 124 amino acids long.
The sequence is show below: MLLKVPSVDWTDQIIYVVDDDESLSDIDDEPDFSEYMWMENEEEFDKNELQRLEEEEIMQECFEAMIEDELEEQINEWEKAKTDEQNTALSALPKSQCDVEKSVLNPMADEFVPRCHVIDFPAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry