AibGenesis™ Mouse Anti-Pcid2 Antibody (CBMOAB-27324FYA)


Cat: CBMOAB-27324FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27324FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO27324FYA 100 µg
CBMOAB-54024FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO54024FYA 100 µg
CBMOAB-91846FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91846FYA 100 µg
MO-AB-12345W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12345W 100 µg
MO-AB-17617R Monoclonal Cattle (Bos taurus) WB, ELISA MO17617R 100 µg
MO-AB-61124W Monoclonal Marmoset WB, ELISA MO61124W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO27324FYA
SpecificityThis antibody binds to fruit fly Pcid2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the TREX-2 complex (transcription and export complex 2), which regulates mRNA export from the nucleus. This protein regulates expression of Mad2 mitotic arrest deficient-like 1, a cell division checkpoint protein. This protein also interacts with and stabilizes Brca2 (breast cancer 2) protein. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Pcid2 Antibody is a mouse antibody against Pcid2. It can be used for Pcid2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPCI domain-containing protein 2 homolog; dmPCID2; CSN12-like protein; PCID2
UniProt IDQ9VTL1
Protein RefseqThe length of the protein is 395 amino acids long.
The sequence is show below: MFGTVNNYLSGVLHAAQDLDGESLATYLSLRDVHVQNHNLYIAQPEKLVDRFLKPPLDEVVSAHLKVLYHLAQEPPGYMEAYTQQSAACGAVVRLLQQLKDENWCLPLMYRVCLDLRYLAQACEKHCQGFTPGHVLEKAADCIMACFRVCAADGRASEEDTKRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFKDSFPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPDRFASNKRLILIYLVPVKMLLGYLPSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQELVLIRSGIYLLVEKLKFLVYRNLFKKVFVIRKSHQLDMGDFLSALHFVGLTDVSLDETHCIVANLIYDGKIKGYISHAHNKLVVSKQNPFPSVSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry