AibGenesis™ Mouse Anti-Pelo Antibody (CBMOAB-27439FYA)


Cat: CBMOAB-27439FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27439FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO27439FYA 100 µg
CBMOAB-92192FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92192FYA 100 µg
MO-AB-17762R Monoclonal Cattle (Bos taurus) WB, ELISA MO17762R 100 µg
MO-AB-19265W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19265W 100 µg
MO-AB-61292W Monoclonal Marmoset WB, ELISA MO61292W 100 µg
MO-DKB-00832W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO27439FYA
SpecificityThis antibody binds to fruit fly Pelo.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Pelo Antibody is a mouse antibody against Pelo. It can be used for Pelo detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein pelota; EC 3.1.-.-; pelo
UniProt IDP48612
Protein RefseqThe length of the protein is 395 amino acids long.
The sequence is show below: MKLLGKYVDKGMQGNVTLVPEESEDMWHAYNLIAKGDSVRSTTIRKVQNETATGSSTSSRVRTTLTIAVESIDFDTQACVLRLKGRNIEENQYVKMGAYHTLDLELNRKFELRKPEWDTIALERIEMACDPTQSADVAAVVMQEGLAHVCLITASMTLVRSKIEVSIPRKRKGSVQQHEKGLAKFYEQVMQSILRHVNFDVVKCVLIASPGFVRDQFYDYMFQQAVKMDYKLLLDNKSKFMLVHASSGFKHSLREILQDPAVLAKMSDTKAAGEVKALEQFYMMLQCEPAKAFYGKKHVLQAAESQAIETLLISDNLFRCQDVSLRKEYVNLVESIRDAGGEVKIFSSMHISGEQLAQLTGIAALLRFPMPELEDSDDDDDEDGAAGGVADSDSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry