Mouse Anti-Rhou Antibody (CBMOAB-29761FYA)


Cat: CBMOAB-29761FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-29761FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO29761FYA 100 µg
CBMOAB-56491FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56491FYA 100 µg
MO-AB-07116H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07116C 100 µg
MO-AB-19283R Monoclonal Cattle (Bos taurus) WB, ELISA MO19283R 100 µg
MO-AB-63301W Monoclonal Marmoset WB, ELISA MO63301W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO29761FYA
SpecificityThis antibody binds to fruit fly Rhou.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Rhou Antibody is a mouse antibody against Rhou. It can be used for Rhou detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRhoU, isoform B; RhoU, isoform C; RhoU
UniProt IDQ0KHU4
Protein RefseqThe length of the protein is 582 amino acids long.
The sequence is show below: MTVKLAKLFGGVTTGGIEILDSPGNPQQHQEQQHLQQQQQQPLTAPQQHMQQQPPPLPPPNANMKSLKYYEHLQATYDCHDLMDHDQDQDDYEDTCMQRNHPYNNSQRPLLGDRRPQLTVMSVGKKGAKSGMQVQNLPPLPPLRTYISPYVQQQKRDSAKGLHGFNDFDALSQQYNQHLQSPHIGYPYGSPPSPTAQSSDFCFDRQTGLVMLPGTAGGQVSSSSSSNCSSSHTTSTSSPTRYYPDNPGHATGLFASRFEDDFCMRRPAVQESSSPIIAGGCGGGTGSGSGVALGVGGGPFIFGIAPEQQVTDYGSNPLPPTPPQLKQQSVISRSPLQQSLSDTSAASSGKGSKFLLRKRKSKKTTAAAAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKFAKTKAALILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTIGAKYIETSSATQDKVKDVFDTAIWEGLVPTTLPPTPSFWRKLFCLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry